-
-
-
Tổng tiền thanh toán:
-
G-CSF, Granulocyte Colony Stimulating Factor, monkey (rhesus macaque)
Thương hiệu: Bio Basic-Canada
| Tình trạng:
Còn hàng
0₫
G-CSF, Granulocyte Colony Stimulating Factor, monkey (rhesus macaque)
CAT: RC223-13
Purity: >98% by SDS-PAGE and HPLC analyses.
Storage: (-15 to -20)C
Gọi ngay 0936 35 33 79 để có được giá tốt nhất!
-
Mô tả sản phẩm
-
Hỗ trợ khách hàng
-
Đánh giá sản phẩm
G-CSF, Granulocyte Colony Stimulating Factor, monkey (rhesus macaque)
CAT: RC223-13
Purity: >98% by SDS-PAGE and HPLC analyses.
Storage: (-15 to -20)C
Sterile: Yes
Formulation: Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
Product Description: G-CSF, Granulocyte Colony Stimulating Factor, monkey (rhesus macaque): Rhesus macaque Granulocyte Colony Stimulating Factor
GCSF is a pleiotropic cytokine best known for its specific effects on the proliferation, differentiation, and activation of hematopoietic cells of the neutrophilic granulocyte lineage. It is produced mainly by monocytes and macrophages upon activation by endotoxin, TNFα and IFNγ. Other cell types including fibroblasts, endothelial cells, astrocytes and bone marrow stromal cells can also secrete GCSF after LPS, IL1 or TNFα activation. In addition, various carcinoma cell lines and myeloblastic leukemia cells can express GCSF constitutively.
Source: Escherichia coli.
Molecular Weight: Approximately 18.9 kDa, a single non-glycosylated polypeptide chain containing 174 amino acids.
Quantity: 2ug/10ug/1mg
AASequence: TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEEL VLLRHSLGIP WAPLSSCPSQALQLTGCLSQLHSSLFLYQGLLQALEGISPELSPTLDT LQLDIADFAT TIWQQMEDLGMAPALQPTQGAMPAFTSAFQRRAGGVLVASHLQRF LELAYRVLR HLAQS
Purity: >98% by SDS-PAGE and HPLC analyses.
Biological Activity: The ED50 as calculated by the dose-dependent stimulation of the proliferation of murine M-NFS-60 cells is less than 0.1 ng/ml, corresponding to a Specific Activity of 1.0×107 IU/mg.
Formulation: Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
Endotoxin: Less than 1EU/mg of rRhG-CSF as determined by LAL method.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions
, Accession number: XM_001095097, UnitProt ID: F7H1Q6-1
Để được hỗ trợ / khắc phục sự cố sản phẩm,
xin vui lòng gửi email cho chúng tôi yêu cầu của bạn tại:
Email: info@labtech.com.vn
Hotline: 0936353379
Giao hàng nhanh chóng
Chỉ trong vòng 24h đồng hồSản phẩm chính hãng
Sản phẩm nhập khẩu 100%Đổi trả cực kì dễ dàng
Đổi trả trong 2 ngày đầu tiênMua hàng tiết kiệm
Tiết kiệm hơn từ 10% - 30%Hotline :
0936 35 33 79